GMFB polyclonal antibody
  • GMFB polyclonal antibody

GMFB polyclonal antibody

Ref: AB-PAB28621
GMFB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GMFB.
Información adicional
Size 100 uL
Gene Name GMFB
Gene Alias GMF
Gene Description glia maturation factor, beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GMFB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2764
Iso type IgG

Enviar uma mensagem


GMFB polyclonal antibody

GMFB polyclonal antibody