AADAC polyclonal antibody
  • AADAC polyclonal antibody

AADAC polyclonal antibody

Ref: AB-PAB28608
AADAC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AADAC.
Información adicional
Size 100 uL
Gene Name AADAC
Gene Alias CES5A1|DAC
Gene Description arylacetamide deacetylase (esterase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AADAC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 13
Iso type IgG

Enviar uma mensagem


AADAC polyclonal antibody

AADAC polyclonal antibody