ODZ1 polyclonal antibody
  • ODZ1 polyclonal antibody

ODZ1 polyclonal antibody

Ref: AB-PAB28599
ODZ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ODZ1.
Información adicional
Size 100 uL
Gene Name ODZ1
Gene Alias ODZ3|TEN-M1|TNM|TNM1
Gene Description odz, odd Oz/ten-m homolog 1(Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IRTISRNQAHLNDMNIYEIASPADQELYQFTVNGTHLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGH
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ODZ1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10178
Iso type IgG

Enviar uma mensagem


ODZ1 polyclonal antibody

ODZ1 polyclonal antibody