DSN1 polyclonal antibody
  • DSN1 polyclonal antibody

DSN1 polyclonal antibody

Ref: AB-PAB28597
DSN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DSN1.
Información adicional
Size 100 uL
Gene Name DSN1
Gene Alias C20orf172|FLJ13346|MGC32987|MIS13|dJ469A13.2
Gene Description DSN1, MIND kinetochore complex component, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPA
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DSN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79980
Iso type IgG

Enviar uma mensagem


DSN1 polyclonal antibody

DSN1 polyclonal antibody