LCN2 polyclonal antibody
  • LCN2 polyclonal antibody

LCN2 polyclonal antibody

Ref: AB-PAB28594
LCN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LCN2.
Información adicional
Size 100 uL
Gene Name LCN2
Gene Alias NGAL
Gene Description lipocalin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LCN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3934
Iso type IgG

Enviar uma mensagem


LCN2 polyclonal antibody

LCN2 polyclonal antibody