EIF1AX polyclonal antibody
  • EIF1AX polyclonal antibody

EIF1AX polyclonal antibody

Ref: AB-PAB28590
EIF1AX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EIF1AX.
Información adicional
Size 100 uL
Gene Name EIF1AX
Gene Alias EIF1A|EIF1AP1|EIF4C|eIF-1A|eIF-4C
Gene Description eukaryotic translation initiation factor 1A, X-linked
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Form Liquid
Recomended Dilution Western Blot (0.04-0.4 ug/mL)
Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EIF1AX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1964
Iso type IgG

Enviar uma mensagem


EIF1AX polyclonal antibody

EIF1AX polyclonal antibody