DDX24 polyclonal antibody
  • DDX24 polyclonal antibody

DDX24 polyclonal antibody

Ref: AB-PAB28588
DDX24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX24.
Información adicional
Size 100 uL
Gene Name DDX24
Gene Alias -
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57062
Iso type IgG

Enviar uma mensagem


DDX24 polyclonal antibody

DDX24 polyclonal antibody