FMNL3 polyclonal antibody
  • FMNL3 polyclonal antibody

FMNL3 polyclonal antibody

Ref: AB-PAB28587
FMNL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FMNL3.
Información adicional
Size 100 uL
Gene Name FMNL3
Gene Alias DKFZp762B245|FHOD3|FLJ45265|MGC45819|WBP3
Gene Description formin-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FMNL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91010
Iso type IgG

Enviar uma mensagem


FMNL3 polyclonal antibody

FMNL3 polyclonal antibody