HS3ST1 polyclonal antibody
  • HS3ST1 polyclonal antibody

HS3ST1 polyclonal antibody

Ref: AB-PAB28581
HS3ST1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HS3ST1.
Información adicional
Size 100 uL
Gene Name HS3ST1
Gene Alias 3OST|3OST1
Gene Description heparan sulfate (glucosamine) 3-O-sulfotransferase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HS3ST1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9957
Iso type IgG

Enviar uma mensagem


HS3ST1 polyclonal antibody

HS3ST1 polyclonal antibody