LONP1 polyclonal antibody
  • LONP1 polyclonal antibody

LONP1 polyclonal antibody

Ref: AB-PAB28578
LONP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LONP1.
Información adicional
Size 100 uL
Gene Name LONP1
Gene Alias LON|LONP|LonHS|MGC1498|PIM1|PRSS15|hLON
Gene Description lon peptidase 1, mitochondrial
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Form Liquid
Recomended Dilution Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)

The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LONP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9361
Iso type IgG

Enviar uma mensagem


LONP1 polyclonal antibody

LONP1 polyclonal antibody