IFI16 polyclonal antibody
  • IFI16 polyclonal antibody

IFI16 polyclonal antibody

Ref: AB-PAB28576
IFI16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFI16.
Información adicional
Size 100 uL
Gene Name IFI16
Gene Alias IFNGIP1|MGC9466|PYHIN2
Gene Description interferon, gamma-inducible protein 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IFI16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3428
Iso type IgG

Enviar uma mensagem


IFI16 polyclonal antibody

IFI16 polyclonal antibody