PSMD14 polyclonal antibody
  • PSMD14 polyclonal antibody

PSMD14 polyclonal antibody

Ref: AB-PAB28572
PSMD14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMD14.
Información adicional
Size 100 uL
Gene Name PSMD14
Gene Alias PAD1|POH1|rpn11
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA
Form Liquid
Recomended Dilution Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PSMD14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10213
Iso type IgG

Enviar uma mensagem


PSMD14 polyclonal antibody

PSMD14 polyclonal antibody