KDM6A polyclonal antibody
  • KDM6A polyclonal antibody

KDM6A polyclonal antibody

Ref: AB-PAB28570
KDM6A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KDM6A.
Información adicional
Size 100 uL
Gene Name KDM6A
Gene Alias UTX|KABUK2|bA386N14.2
Gene Description lysine (K)-specific demethylase 6A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KDM6A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7403
Iso type IgG

Enviar uma mensagem


KDM6A polyclonal antibody

KDM6A polyclonal antibody