ORAI3 polyclonal antibody
  • ORAI3 polyclonal antibody

ORAI3 polyclonal antibody

Ref: AB-PAB28562
ORAI3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ORAI3.
Información adicional
Size 100 uL
Gene Name ORAI3
Gene Alias MGC13024|TMEM142C
Gene Description ORAI calcium release-activated calcium modulator 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ORAI3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93129
Iso type IgG

Enviar uma mensagem


ORAI3 polyclonal antibody

ORAI3 polyclonal antibody