BTG2 polyclonal antibody
  • BTG2 polyclonal antibody

BTG2 polyclonal antibody

Ref: AB-PAB28556
BTG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BTG2.
Información adicional
Size 100 uL
Gene Name BTG2
Gene Alias MGC126063|MGC126064|PC3|TIS21
Gene Description BTG family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant BTG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7832
Iso type IgG

Enviar uma mensagem


BTG2 polyclonal antibody

BTG2 polyclonal antibody