MVP polyclonal antibody
  • MVP polyclonal antibody

MVP polyclonal antibody

Ref: AB-PAB28550
MVP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MVP.
Información adicional
Size 100 uL
Gene Name MVP
Gene Alias LRP|VAULT1
Gene Description major vault protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLS
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant MVP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9961
Iso type IgG

Enviar uma mensagem


MVP polyclonal antibody

MVP polyclonal antibody