PLVAP polyclonal antibody
  • PLVAP polyclonal antibody

PLVAP polyclonal antibody

Ref: AB-PAB28548
PLVAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLVAP.
Información adicional
Size 100 uL
Gene Name PLVAP
Gene Alias FELS|PV-1|PV1|gp68
Gene Description plasmalemma vesicle associated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PLVAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83483
Iso type IgG

Enviar uma mensagem


PLVAP polyclonal antibody

PLVAP polyclonal antibody