A2M polyclonal antibody
  • A2M polyclonal antibody

A2M polyclonal antibody

Ref: AB-PAB28545
A2M polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant A2M.
Información adicional
Size 100 uL
Gene Name A2M
Gene Alias CPAMD5|DKFZp779B086|FWP007|S863-7
Gene Description alpha-2-macroglobulin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(-)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant A2M.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2
Iso type IgG

Enviar uma mensagem


A2M polyclonal antibody

A2M polyclonal antibody