CALR polyclonal antibody
  • CALR polyclonal antibody

CALR polyclonal antibody

Ref: AB-PAB28544
CALR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CALR.
Información adicional
Size 100 uL
Gene Name CALR
Gene Alias CRT|FLJ26680|RO|SSA|cC1qR
Gene Description calreticulin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDS
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CALR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 811
Iso type IgG

Enviar uma mensagem


CALR polyclonal antibody

CALR polyclonal antibody