CCT5 polyclonal antibody
  • CCT5 polyclonal antibody

CCT5 polyclonal antibody

Ref: AB-PAB28543
CCT5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCT5.
Información adicional
Size 100 uL
Gene Name CCT5
Gene Alias CCT-epsilon|CCTE|KIAA0098|TCP-1-epsilon
Gene Description chaperonin containing TCP1, subunit 5 (epsilon)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQM
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CCT5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22948
Iso type IgG

Enviar uma mensagem


CCT5 polyclonal antibody

CCT5 polyclonal antibody