NXF2B polyclonal antibody
  • NXF2B polyclonal antibody

NXF2B polyclonal antibody

Ref: AB-PAB28542
NXF2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NXF2B.
Información adicional
Size 100 uL
Gene Name NXF2B
Gene Alias FLJ54838|bA353J17.1
Gene Description nuclear RNA export factor 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NXF2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 728343
Iso type IgG

Enviar uma mensagem


NXF2B polyclonal antibody

NXF2B polyclonal antibody