FBLN2 polyclonal antibody
  • FBLN2 polyclonal antibody

FBLN2 polyclonal antibody

Ref: AB-PAB28537
FBLN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBLN2.
Información adicional
Size 100 uL
Gene Name FBLN2
Gene Alias -
Gene Description fibulin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBLN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2199
Iso type IgG

Enviar uma mensagem


FBLN2 polyclonal antibody

FBLN2 polyclonal antibody