NFE2 polyclonal antibody
  • NFE2 polyclonal antibody

NFE2 polyclonal antibody

Ref: AB-PAB28536
NFE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NFE2.
Información adicional
Size 100 uL
Gene Name NFE2
Gene Alias NF-E2|p45
Gene Description nuclear factor (erythroid-derived 2), 45kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NFE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4778
Iso type IgG

Enviar uma mensagem


NFE2 polyclonal antibody

NFE2 polyclonal antibody