TAF7L polyclonal antibody
  • TAF7L polyclonal antibody

TAF7L polyclonal antibody

Ref: AB-PAB28528
TAF7L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TAF7L.
Información adicional
Size 100 uL
Gene Name TAF7L
Gene Alias FLJ23157|TAF2Q|dJ738A13.1
Gene Description TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TAF7L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54457
Iso type IgG

Enviar uma mensagem


TAF7L polyclonal antibody

TAF7L polyclonal antibody