CHEK2 polyclonal antibody
  • CHEK2 polyclonal antibody

CHEK2 polyclonal antibody

Ref: AB-PAB28527
CHEK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHEK2.
Información adicional
Size 100 uL
Gene Name CHEK2
Gene Alias CDS1|CHK2|HuCds1|LFS2|PP1425|RAD53
Gene Description CHK2 checkpoint homolog (S. pombe)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNG
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHEK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11200
Iso type IgG

Enviar uma mensagem


CHEK2 polyclonal antibody

CHEK2 polyclonal antibody