VAV1 polyclonal antibody
  • VAV1 polyclonal antibody

VAV1 polyclonal antibody

Ref: AB-PAB28500
VAV1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VAV1.
Información adicional
Size 100 uL
Gene Name VAV1
Gene Alias VAV
Gene Description vav 1 guanine nucleotide exchange factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VAV1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7409
Iso type IgG

Enviar uma mensagem


VAV1 polyclonal antibody

VAV1 polyclonal antibody