IRF9 polyclonal antibody
  • IRF9 polyclonal antibody

IRF9 polyclonal antibody

Ref: AB-PAB28499
IRF9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IRF9.
Información adicional
Size 100 uL
Gene Name IRF9
Gene Alias IRF-9|ISGF3|ISGF3G|p48
Gene Description interferon regulatory factor 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLER
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:250-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IRF9
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10379
Iso type IgG

Enviar uma mensagem


IRF9 polyclonal antibody

IRF9 polyclonal antibody