INTS6 polyclonal antibody
  • INTS6 polyclonal antibody

INTS6 polyclonal antibody

Ref: AB-PAB28493
INTS6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INTS6.
Información adicional
Size 100 uL
Gene Name INTS6
Gene Alias DBI-1|DDX26|DDX26A|DICE1|DKFZp434B105|HDB|INT6|Notchl2
Gene Description integrator complex subunit 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:250 - 1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INTS6
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26512
Iso type IgG

Enviar uma mensagem


INTS6 polyclonal antibody

INTS6 polyclonal antibody