BRD8 polyclonal antibody
  • BRD8 polyclonal antibody

BRD8 polyclonal antibody

Ref: AB-PAB28491
BRD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BRD8.
Información adicional
Size 100 uL
Gene Name BRD8
Gene Alias SMAP|SMAP2|p120
Gene Description bromodomain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EASPESMLSPSHGSNPIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCSEDQEAIQAQKIWKKAIMLVWRAA
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BRD8
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10902
Iso type IgG

Enviar uma mensagem


BRD8 polyclonal antibody

BRD8 polyclonal antibody