MZF1 polyclonal antibody
  • MZF1 polyclonal antibody

MZF1 polyclonal antibody

Ref: AB-PAB28482
MZF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MZF1.
Información adicional
Size 100 uL
Gene Name MZF1
Gene Alias MZF-1|MZF1B|ZNF42|ZSCAN6|Zfp98
Gene Description myeloid zinc finger 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MZF1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7593
Iso type IgG

Enviar uma mensagem


MZF1 polyclonal antibody

MZF1 polyclonal antibody