ELF1 polyclonal antibody
  • ELF1 polyclonal antibody

ELF1 polyclonal antibody

Ref: AB-PAB28481
ELF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ELF1.
Información adicional
Size 100 uL
Gene Name ELF1
Gene Alias -
Gene Description E74-like factor 1 (ets domain transcription factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQL
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ELF1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1997
Iso type IgG

Enviar uma mensagem


ELF1 polyclonal antibody

ELF1 polyclonal antibody