TOM1 polyclonal antibody
  • TOM1 polyclonal antibody

TOM1 polyclonal antibody

Ref: AB-PAB28480
TOM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOM1.
Información adicional
Size 100 uL
Gene Name TOM1
Gene Alias FLJ33404
Gene Description target of myb1 (chicken)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:250-1:500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOM1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10043
Iso type IgG

Enviar uma mensagem


TOM1 polyclonal antibody

TOM1 polyclonal antibody