DLG3 polyclonal antibody
  • DLG3 polyclonal antibody

DLG3 polyclonal antibody

Ref: AB-PAB28478
DLG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DLG3.
Información adicional
Size 100 uL
Gene Name DLG3
Gene Alias KIAA1232|MRX|MRX90|NE-Dlg|NEDLG|SAP-102|SAP102
Gene Description discs, large homolog 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DLG3
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1741
Iso type IgG

Enviar uma mensagem


DLG3 polyclonal antibody

DLG3 polyclonal antibody