RBP4 polyclonal antibody
  • RBP4 polyclonal antibody

RBP4 polyclonal antibody

Ref: AB-PAB28469
RBP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBP4.
Información adicional
Size 100 uL
Gene Name RBP4
Gene Alias -
Gene Description retinol binding protein 4, plasma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBP4
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5950
Iso type IgG

Enviar uma mensagem


RBP4 polyclonal antibody

RBP4 polyclonal antibody