NP polyclonal antibody
  • NP polyclonal antibody

NP polyclonal antibody

Ref: AB-PAB28465
NP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NP.
Información adicional
Size 100 uL
Gene Name NP
Gene Alias FLJ94043|FLJ97288|FLJ97312|MGC117396|MGC125915|MGC125916|PNP|PRO1837|PUNP
Gene Description nucleoside phosphorylase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NP
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4860
Iso type IgG

Enviar uma mensagem


NP polyclonal antibody

NP polyclonal antibody