MASP1 polyclonal antibody
  • MASP1 polyclonal antibody

MASP1 polyclonal antibody

Ref: AB-PAB28463
MASP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MASP1.
Información adicional
Size 100 uL
Gene Name MASP1
Gene Alias CRARF|CRARF1|DKFZp686I01199|FLJ26383|MASP|MGC126283|MGC126284|PRSS5|RaRF
Gene Description mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MASP1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5648
Iso type IgG

Enviar uma mensagem


MASP1 polyclonal antibody

MASP1 polyclonal antibody