FBLN1 polyclonal antibody
  • FBLN1 polyclonal antibody

FBLN1 polyclonal antibody

Ref: AB-PAB28461
FBLN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBLN1.
Información adicional
Size 100 uL
Gene Name FBLN1
Gene Alias FBLN
Gene Description fibulin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBLN1
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2192
Iso type IgG

Enviar uma mensagem


FBLN1 polyclonal antibody

FBLN1 polyclonal antibody