RBM39 polyclonal antibody
  • RBM39 polyclonal antibody

RBM39 polyclonal antibody

Ref: AB-PAB28454
RBM39 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM39.
Información adicional
Size 100 uL
Gene Name RBM39
Gene Alias CAPER|CAPERalpha|CC1.3|DKFZp781C0423|FLJ44170|HCC1|RNPC2|fSAP59
Gene Description RNA binding motif protein 39
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
Form Liquid
Recomended Dilution Immunohistochemistry( 1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RBM39.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9584
Iso type IgG

Enviar uma mensagem


RBM39 polyclonal antibody

RBM39 polyclonal antibody