ZNF133 polyclonal antibody
  • ZNF133 polyclonal antibody

ZNF133 polyclonal antibody

Ref: AB-PAB28443
ZNF133 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF133.
Información adicional
Size 100 uL
Gene Name ZNF133
Gene Alias ZNF150|pHZ-13|pHZ-66
Gene Description zinc finger protein 133
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SKPELITQLEQGKETWREEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPGDPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLG
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ZNF133.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7692
Iso type IgG

Enviar uma mensagem


ZNF133 polyclonal antibody

ZNF133 polyclonal antibody