ECE1 polyclonal antibody
  • ECE1 polyclonal antibody

ECE1 polyclonal antibody

Ref: AB-PAB28442
ECE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ECE1.
Información adicional
Size 100 uL
Gene Name ECE1
Gene Alias ECE
Gene Description endothelin converting enzyme 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKR
Form Liquid
Recomended Dilution Immunohistochemistry(1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ECE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1889
Iso type IgG

Enviar uma mensagem


ECE1 polyclonal antibody

ECE1 polyclonal antibody