IL1RN polyclonal antibody
  • IL1RN polyclonal antibody

IL1RN polyclonal antibody

Ref: AB-PAB28441
IL1RN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL1RN.
Información adicional
Size 100 uL
Gene Name IL1RN
Gene Alias ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant IL1RN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3557
Iso type IgG

Enviar uma mensagem


IL1RN polyclonal antibody

IL1RN polyclonal antibody