PTS polyclonal antibody
  • PTS polyclonal antibody

PTS polyclonal antibody

Ref: AB-PAB28440
PTS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PTS.
Información adicional
Size 100 uL
Gene Name PTS
Gene Alias FLJ97081|PTPS
Gene Description 6-pyruvoyltetrahydropterin synthase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq RCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIV
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PTS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5805
Iso type IgG

Enviar uma mensagem


PTS polyclonal antibody

PTS polyclonal antibody