STX7 polyclonal antibody
  • STX7 polyclonal antibody

STX7 polyclonal antibody

Ref: AB-PAB28438
STX7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STX7.
Información adicional
Size 100 uL
Gene Name STX7
Gene Alias -
Gene Description syntaxin 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
Western Blot(1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant STX7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8417
Iso type IgG

Enviar uma mensagem


STX7 polyclonal antibody

STX7 polyclonal antibody