LGMN polyclonal antibody
  • LGMN polyclonal antibody

LGMN polyclonal antibody

Ref: AB-PAB28433
LGMN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LGMN.
Información adicional
Size 100 uL
Gene Name LGMN
Gene Alias AEP|LGMN1|PRSC1
Gene Description legumain
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY
Form Liquid
Recomended Dilution Immunohistochemistry(1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant LGMN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5641
Iso type IgG

Enviar uma mensagem


LGMN polyclonal antibody

LGMN polyclonal antibody