TXNRD1 polyclonal antibody
  • TXNRD1 polyclonal antibody

TXNRD1 polyclonal antibody

Ref: AB-PAB28426
TXNRD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNRD1.
Información adicional
Size 100 uL
Gene Name TXNRD1
Gene Alias GRIM-12|MGC9145|TR|TR1|TRXR1|TXNR
Gene Description thioredoxin reductase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG
Form Liquid
Recomended Dilution Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TXNRD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7296
Iso type IgG

Enviar uma mensagem


TXNRD1 polyclonal antibody

TXNRD1 polyclonal antibody