FLOT1 polyclonal antibody
  • FLOT1 polyclonal antibody

FLOT1 polyclonal antibody

Ref: AB-PAB28424
FLOT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLOT1.
Información adicional
Size 100 uL
Gene Name FLOT1
Gene Alias -
Gene Description flotillin 1
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Form Liquid
Recomended Dilution Western Blot (Human: 1:250-1:500, Rodent: 1:100-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FLOT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10211
Iso type IgG

Enviar uma mensagem


FLOT1 polyclonal antibody

FLOT1 polyclonal antibody