ERBB2 polyclonal antibody
  • ERBB2 polyclonal antibody

ERBB2 polyclonal antibody

Ref: AB-PAB28423
ERBB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ERBB2.
Información adicional
Size 100 uL
Gene Name ERBB2
Gene Alias CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1
Gene Description v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ERBB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2064
Iso type IgG

Enviar uma mensagem


ERBB2 polyclonal antibody

ERBB2 polyclonal antibody