PNN polyclonal antibody
  • PNN polyclonal antibody

PNN polyclonal antibody

Ref: AB-PAB28421
PNN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNN.
Información adicional
Size 100 uL
Gene Name PNN
Gene Alias DRS|SDK3|memA|pinin
Gene Description pinin, desmosome associated protein
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq EQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKE
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PNN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5411
Iso type IgG

Enviar uma mensagem


PNN polyclonal antibody

PNN polyclonal antibody