APOA4 polyclonal antibody
  • APOA4 polyclonal antibody

APOA4 polyclonal antibody

Ref: AB-PAB28418
APOA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant APOA4.
Información adicional
Size 100 uL
Gene Name APOA4
Gene Alias MGC142154|MGC142156
Gene Description apolipoprotein A-IV
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human APOA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 337
Iso type IgG

Enviar uma mensagem


APOA4 polyclonal antibody

APOA4 polyclonal antibody