RAB27A polyclonal antibody
  • RAB27A polyclonal antibody

RAB27A polyclonal antibody

Ref: AB-PAB28415
RAB27A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB27A.
Información adicional
Size 100 uL
Gene Name RAB27A
Gene Alias GS2|HsT18676|MGC117246|RAB27|RAM
Gene Description RAB27A, member RAS oncogene family
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RAB27A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5873
Iso type IgG

Enviar uma mensagem


RAB27A polyclonal antibody

RAB27A polyclonal antibody